PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G0961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 203aa    MW: 22520.8 Da    PI: 8.412
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G0961genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA105.35.2e-33108164158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  +ep++VNaKQy++Il+RRq+Rak+e+e+kl +ksrkpylheSRh hAlrR+RgsgGrF
  Gh_A05G0961 108 EEPVFVNAKQYHGILRRRQSRAKAESENKL-AKSRKPYLHESRHLHALRRARGSGGRF 164
                  69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.4E-36106167IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.039107167IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.5E-28109164IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.7E-24110132IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860112132IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.7E-24141164IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MTSSAHDLSD NNEVDEQKIH SEFSDHSSSP VTGLSPSSIT TPYMPYTTPQ HAVAPAAYPY  60
PDPYYRSIFA PYDAQSYPPQ PYGGQPMVHL QLMGIQQAGV PLPSDAVEEP VFVNAKQYHG  120
ILRRRQSRAK AESENKLAKS RKPYLHESRH LHALRRARGS GGRFLNSKKN ENKQNEAAPS  180
DKSQSNINLN SDKNELASTE GNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-22107172166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4227751e-62AM422775.1 Antirrhinum majus mRNA for YA6 (nf-YA gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012443085.11e-147PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443084.11e-147PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443083.11e-147PREDICTED: nuclear transcription factor Y subunit A-7-like
RefseqXP_012443082.11e-147PREDICTED: nuclear transcription factor Y subunit A-7-like
SwissprotQ84JP18e-70NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0B0NSG01e-149A0A0B0NSG0_G
STRINGVIT_10s0003g04650.t011e-109(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.26e-53nuclear factor Y, subunit A7